Class g: Small proteins [56992] (90 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) |
Family g.18.1.1: Complement control module/SCR domain [57536] (14 proteins) Pfam PF00084 |
Protein Interleukin-15 receptor subunit alpha [161139] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [161141] (4 PDB entries) Uniprot Q13261 31-108! Uniprot Q13261 31-96 |
Domain d2z3rl_: 2z3r L: [154017] Other proteins in same PDB: d2z3ra_, d2z3rc_, d2z3re_, d2z3rg_, d2z3ri_, d2z3rk_, d2z3rm_, d2z3ro_ automated match to d2z3qb1 complexed with gol |
PDB Entry: 2z3r (more details), 2 Å
SCOPe Domain Sequences for d2z3rl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z3rl_ g.18.1.1 (L:) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]} isitcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvahwtt pslkcirdpalvhqr
Timeline for d2z3rl_: