SCOPe 2.08: Domain d2z3rl2: 2z3r L:1-73

Lineage for d2z3rl2 (2z3r L:1-73)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein Interleukin-15 receptor subunit alpha [161139] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [161141] (4 PDB entries)
   Uniprot Q13261 31-108! Uniprot Q13261 31-96

8. Domain d2z3rl2: 2z3r L:1-73 [154017]
   Other proteins in same PDB: d2z3ra2, d2z3ra3, d2z3rb3, d2z3rc2, d2z3rc3, d2z3rd3, d2z3re2, d2z3re3, d2z3rf3, d2z3rg2, d2z3rg3, d2z3rh3, d2z3ri2, d2z3ri3, d2z3rj3, d2z3rk2, d2z3rk3, d2z3rl3, d2z3rm2, d2z3rm3, d2z3rn3, d2z3ro2, d2z3ro3, d2z3rp3
   automated match to d2z3qb1
   complexed with gol

Details for d2z3rl2

PDB Entry: 2z3r, 2 Å

PDB Description: Crystal structure of the IL-15/IL-15Ra complex

PDB Compounds: (L:) Interleukin-15 receptor alpha chain

SCOPe Domain Sequences for d2z3rl2:

Sequence; same for both SEQRES and ATOM records:

>d2z3rl2 g.18.1.1 (L:1-73) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]}
itcpppmsvehadiwvksyslysreryicnsgfkrkagtssltecvlnkatnvahwttps
lkcirdpalvhqr

Timeline for d2z3rl2:

• d2z3rl2 first appeared in SCOP 1.75, called d2z3rl1
  
• d2z3rl2 appears in SCOPe 2.07