Lineage for d2z3bb_ (2z3b B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228402Species Bacillus subtilis [TaxId:1423] [187296] (1 PDB entry)
  8. 2228404Domain d2z3bb_: 2z3b B: [153972]
    automated match to d1m4ya_
    complexed with na

Details for d2z3bb_

PDB Entry: 2z3b (more details), 2.5 Å

PDB Description: crystal structure of bacillus subtilis codw, a non-canonical hslv-like peptidase with an impaired catalytic apparatus
PDB Compounds: (B:) ATP-dependent protease hslv

SCOPe Domain Sequences for d2z3bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z3bb_ d.153.1.4 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
ssfhattifavqhkgrsamsgdgqvtfgqavvmkhtarkvrklfngkvlagfagsvadaf
tlfekfeakleeyngnlkraavelakewrsdkvlrkleamlivmnqdtlllvsgtgevie
pddgilaigsggnyalaagralkkhagesmsaseiaraaletageicvytndqiileele

SCOPe Domain Coordinates for d2z3bb_:

Click to download the PDB-style file with coordinates for d2z3bb_.
(The format of our PDB-style files is described here.)

Timeline for d2z3bb_: