Lineage for d2z1aa1 (2z1a A:330-534)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1923637Fold d.114: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55815] (1 superfamily)
    core: alpha-beta(2)-alpha-beta(2)-alpha-beta; 3 layers; mixed sheet: order 31425
  4. 1923638Superfamily d.114.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55816] (2 families) (S)
  5. 1923639Family d.114.1.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55817] (1 protein)
  6. 1923640Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55818] (3 species)
  7. 1923657Species Thermus thermophilus [TaxId:274] [160694] (1 PDB entry)
    Uniprot Q5SIP1 330-534
  8. 1923658Domain d2z1aa1: 2z1a A:330-534 [153927]
    Other proteins in same PDB: d2z1aa2
    complexed with po4, thm, zn

Details for d2z1aa1

PDB Entry: 2z1a (more details), 1.75 Å

PDB Description: Crystal structure of 5'-nucleotidase precursor from Thermus thermophilus HB8
PDB Compounds: (A:) 5'-nucleotidase

SCOPe Domain Sequences for d2z1aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2z1aa1 d.114.1.1 (A:330-534) 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain {Thermus thermophilus [TaxId: 274]}
mqqviaeakvdlvgeravvrrresnlgnlitdgmlwktrnagtqialqngggirasipkg
pitvgkvyevlpfgntlvvmdlkgkeilaalengvsqwentagrflqvsglryafdlsrp
agsrvvrvevktekgyvpldleatyrvvvnnfianggdgftvlkeaqgyrvdtgfsdaes
fmdylkelkvveaglegrievlnep

SCOPe Domain Coordinates for d2z1aa1:

Click to download the PDB-style file with coordinates for d2z1aa1.
(The format of our PDB-style files is described here.)

Timeline for d2z1aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2z1aa2