Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.114: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55815] (1 superfamily) core: alpha-beta(2)-alpha-beta(2)-alpha-beta; 3 layers; mixed sheet: order 31425 |
Superfamily d.114.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55816] (2 families) |
Family d.114.1.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55817] (1 protein) |
Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55818] (3 species) |
Species Thermus thermophilus [TaxId:274] [160694] (1 PDB entry) Uniprot Q5SIP1 330-534 |
Domain d2z1aa1: 2z1a A:330-534 [153927] Other proteins in same PDB: d2z1aa2 complexed with po4, thm, zn |
PDB Entry: 2z1a (more details), 1.75 Å
SCOPe Domain Sequences for d2z1aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z1aa1 d.114.1.1 (A:330-534) 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain {Thermus thermophilus [TaxId: 274]} mqqviaeakvdlvgeravvrrresnlgnlitdgmlwktrnagtqialqngggirasipkg pitvgkvyevlpfgntlvvmdlkgkeilaalengvsqwentagrflqvsglryafdlsrp agsrvvrvevktekgyvpldleatyrvvvnnfianggdgftvlkeaqgyrvdtgfsdaes fmdylkelkvveaglegrievlnep
Timeline for d2z1aa1: