Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.2: 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56307] (2 proteins) |
Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56308] (3 species) |
Species Thermus thermophilus [TaxId:274] [160867] (1 PDB entry) Uniprot Q5SIP1 28-534 |
Domain d2z1aa2: 2z1a A:28-329 [153928] Other proteins in same PDB: d2z1aa1 complexed with po4, thm, zn |
PDB Entry: 2z1a (more details), 1.75 Å
SCOPe Domain Sequences for d2z1aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z1aa2 d.159.1.2 (A:28-329) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Thermus thermophilus [TaxId: 274]} ftltlvhtndthahlepveltlsgektpvggvarrvalfdrvwaraknplfldagdvfqg tlyfnqyrgladryfmhrlryramalgnhefdlgpgpladflkgarfkvvsanvdasrep rlkglfapyavvvvggervgiiglttpdtreisnpgptvafldpyesaqkavyellakgv nkivvlshlgygedlklarrlvgvqvivgghshtllgsfphkelspagpyptvvknpegk dvlvvqawewgkvvgllevtfdakgellaykgeallmtpeaapedffakeallayaqpvm al
Timeline for d2z1aa2: