Lineage for d2z1aa1 (2z1a A:330-534)
- Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.114: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55815] (1 superfamily)
core: alpha-beta(2)-alpha-beta(2)-alpha-beta; 3 layers; mixed sheet: order 31425Superfamily d.114.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55816] (1 family) 
Family d.114.1.1: 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55817] (1 protein) Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain [55818] (3 species) 
Species Thermus thermophilus [TaxId:274] [160694] (1 PDB entry)
Uniprot Q5SIP1 330-534
Domain d2z1aa1: 2z1a A:330-534 [153927]
Other proteins in same PDB: d2z1aa2
complexed with po4, thm, zn
Details for d2z1aa1
PDB Entry: 2z1a (more details), 1.75 Å
PDB Description: Crystal structure of 5'-nucleotidase precursor from Thermus thermophilus HB8
PDB Compounds: (A:) 5'-nucleotidaseSCOP Domain Sequences for d2z1aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2z1aa1 d.114.1.1 (A:330-534) 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain {Thermus thermophilus [TaxId: 274]}
mqqviaeakvdlvgeravvrrresnlgnlitdgmlwktrnagtqialqngggirasipkg
pitvgkvyevlpfgntlvvmdlkgkeilaalengvsqwentagrflqvsglryafdlsrp
agsrvvrvevktekgyvpldleatyrvvvnnfianggdgftvlkeaqgyrvdtgfsdaes
fmdylkelkvveaglegrievlnep
SCOP Domain Coordinates for d2z1aa1:
Click to download the PDB-style file with coordinates for d2z1aa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2z1aa1:
- d2z1aa1 is new in SCOP 1.75
- d2z1aa1 appears in SCOPe 2.01
- d2z1aa1 appears in the current release, SCOPe 2.08
View in 3D
