SCOP 1.75: Domain d2z1aa2: 2z1a A:28-329

Lineage for d2z1aa2 (2z1a A:28-329)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (12 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.2: 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56307] (1 protein)

6. Protein 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain [56308] (3 species)

7. Species Thermus thermophilus [TaxId:274] [160867] (1 PDB entry)
   Uniprot Q5SIP1 28-534

8. Domain d2z1aa2: 2z1a A:28-329 [153928]
   Other proteins in same PDB: d2z1aa1
   complexed with po4, thm, zn

Details for d2z1aa2

PDB Entry: 2z1a, 1.75 Å

PDB Description: Crystal structure of 5'-nucleotidase precursor from Thermus thermophilus HB8

PDB Compounds: (A:) 5'-nucleotidase

SCOP Domain Sequences for d2z1aa2:

Sequence; same for both SEQRES and ATOM records:

>d2z1aa2 d.159.1.2 (A:28-329) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Thermus thermophilus [TaxId: 274]}
ftltlvhtndthahlepveltlsgektpvggvarrvalfdrvwaraknplfldagdvfqg
tlyfnqyrgladryfmhrlryramalgnhefdlgpgpladflkgarfkvvsanvdasrep
rlkglfapyavvvvggervgiiglttpdtreisnpgptvafldpyesaqkavyellakgv
nkivvlshlgygedlklarrlvgvqvivgghshtllgsfphkelspagpyptvvknpegk
dvlvvqawewgkvvgllevtfdakgellaykgeallmtpeaapedffakeallayaqpvm
al

Timeline for d2z1aa2:

• d2z1aa2 is new in SCOP 1.75
  
• d2z1aa2 appears in SCOPe 2.01
  
• d2z1aa2 appears in the current release, SCOPe 2.08