SCOPe 2.04: Domain d2z09a_: 2z09 A:

Lineage for d2z09a_ (2z09 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.4: Universal stress protein-like [52436] (8 proteins)
   Pfam PF00582

6. Protein automated matches [190391] (2 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [187253] (2 PDB entries)

8. Domain d2z09a_: 2z09 A: [153911]
   automated match to d1wjga_
   complexed with acp, mg

Details for d2z09a_

PDB Entry: 2z09, 1.65 Å

PDB Description: crystal structure of uncharacterized conserved protein from thermus thermophilus hb8

PDB Compounds: (A:) Universal stress protein family

SCOPe Domain Sequences for d2z09a_:

Sequence, based on SEQRES records:

>d2z09a_ c.26.2.4 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
mfktillaydgseharraaevakaeaeahgarlivvhayepvpdylgepffeealrrrle
raegvleearaltgvpkedalllegvpaeailqaaraekadlivmgtrglgalgslflgs
qsqrvvaeapcpvllvr

Sequence, based on observed residues (ATOM records):

>d2z09a_ c.26.2.4 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
mfktillaydgseharraaevakaeaeahgarlivvhayeplrrrleraegvleearalt
gvpkedalllegvpaeailqaaraekadlivmgtrglgalgslflgsqsqrvvaeapcpv
llvr

Timeline for d2z09a_:

• d2z09a_ first appeared in SCOP 1.75, called d2z09a1
  
• d2z09a_ appears in SCOPe 2.03
  
• d2z09a_ appears in SCOPe 2.05
  
• d2z09a_ appears in the current release, SCOPe 2.08