Lineage for d2z09a_ (2z09 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861467Family c.26.2.4: Universal stress protein-like [52436] (8 proteins)
    Pfam PF00582
  6. 2861505Protein automated matches [190391] (3 species)
    not a true protein
  7. 2861515Species Thermus thermophilus [TaxId:274] [187253] (2 PDB entries)
  8. 2861517Domain d2z09a_: 2z09 A: [153911]
    automated match to d1wjga_
    complexed with acp, mg

Details for d2z09a_

PDB Entry: 2z09 (more details), 1.65 Å

PDB Description: crystal structure of uncharacterized conserved protein from thermus thermophilus hb8
PDB Compounds: (A:) Universal stress protein family

SCOPe Domain Sequences for d2z09a_:

Sequence, based on SEQRES records: (download)

>d2z09a_ c.26.2.4 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
mfktillaydgseharraaevakaeaeahgarlivvhayepvpdylgepffeealrrrle
raegvleearaltgvpkedalllegvpaeailqaaraekadlivmgtrglgalgslflgs
qsqrvvaeapcpvllvr

Sequence, based on observed residues (ATOM records): (download)

>d2z09a_ c.26.2.4 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
mfktillaydgseharraaevakaeaeahgarlivvhayeplrrrleraegvleearalt
gvpkedalllegvpaeailqaaraekadlivmgtrglgalgslflgsqsqrvvaeapcpv
llvr

SCOPe Domain Coordinates for d2z09a_:

Click to download the PDB-style file with coordinates for d2z09a_.
(The format of our PDB-style files is described here.)

Timeline for d2z09a_: