Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) |
Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
Protein Exochitosanase CsxA, domains 2, 4 and 5 [158903] (1 species) |
Species Amycolatopsis orientalis [TaxId:31958] [158904] (3 PDB entries) Uniprot Q56F26 226-335! Uniprot Q56F26 675-777! Uniprot Q56F26 778-899 |
Domain d2vzsa1: 2vzs A:226-335 [153727] Other proteins in same PDB: d2vzsa4, d2vzsa5, d2vzsb4, d2vzsb5 complexed with cd, gcs, gol |
PDB Entry: 2vzs (more details), 1.85 Å
SCOPe Domain Sequences for d2vzsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vzsa1 b.1.4.1 (A:226-335) Exochitosanase CsxA, domains 2, 4 and 5 {Amycolatopsis orientalis [TaxId: 31958]} avalrsahviqklnsaldhadltvkadvrndsanavqttvagtvagkpisqtvslaaker ktvtfplvgldrpnvwwpagmggqhrydldltasvggtpsdaakskfgvr
Timeline for d2vzsa1: