PDB entry 2vzs

View 2vzs on RCSB PDB site
Description: Chitosan Product complex of Amycolatopsis orientalis exo-chitosanase CsxA
Class: hydrolase
Keywords: exo-beta-d-glucosaminidase, hydrolase, gh2, csxa, glucosamine, glycoside hydrolase
Deposited on 2008-08-05, released 2008-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exo-beta-d-glucosaminidase
    Species: AMYCOLATOPSIS ORIENTALIS [TaxId:31958]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VZS
      • conflict (749)
    • Uniprot Q56F26
    Domains in SCOPe 2.07: d2vzsa1, d2vzsa2, d2vzsa3, d2vzsa4, d2vzsa5
  • Chain 'B':
    Compound: exo-beta-d-glucosaminidase
    Species: AMYCOLATOPSIS ORIENTALIS [TaxId:31958]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VZS
      • conflict (749)
    • Uniprot Q56F26
    Domains in SCOPe 2.07: d2vzsb1, d2vzsb2, d2vzsb3, d2vzsb4, d2vzsb5
  • Heterogens: CD, GCS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vzsA (A:)
    vsfrqkrtripllamtvtalaaavcgvttapaatgaevavplsvgaaagnatpipgyviq
    ssaqvsddsavskpgfptsgwypvssrstvyagllqngkyadpfystnmqnvpaaqfsvp
    wwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdqvngaytrhdlditaqvhtg
    vnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlvrrsgavalrsahviqklns
    aldhadltvkadvrndsanavqttvagtvagkpisqtvslaakerktvtfplvgldrpnv
    wwpagmggqhrydldltasvggtpsdaakskfgvrdvkatlnssggrqysvngkpllirg
    ggytpdlflrwnetaaadklkyvlnlglntvrleghiepdeffdiaddlgvltmpgwecc
    dkwegqvngeekgepwvesdypiakasmfseaerlrdhpsvisfhigsdfapdrrieqgy
    ldamkaadfllpvipaasarpspitgasgmkmngpydyvppvywydksqkdrggawsfns
    etsagvdiptmdtlkrmmsaseldtmwknpsakqyhrsssdtfgnlklfgdaltkrygas
    anlndfvrkaqlsqyenvraefeshsrnytdstnpstgliywmlnspwtslhwqlfdaym
    dqngayygakkaneplhiqyshdnrsvvvinqtsnavsgltattklynldgtekysntkt
    glsvgalgakatavtvpavsglsttylaknvltdssgkevsrnvywlstkadtlnwggsd
    wyytpqsafadlsglnnlgqsavgatansvagadgtttttvtlkntsggrlpafyvdskv
    vdsagkpvlpvewndnavslwpgetttltakyrtadlkgskpsvrisgwntgtqtvpadg
    sgpgpsdpvdyqaedativqgavesnhagytgtgfvnydnvagssvewtvtvpsagtydv
    vvryangtttsrpldfsvngsisasgvafgstgtwpawttktvrvtlaagvnkikavatt
    anggpnvdkitl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vzsA (A:)
    lsvgaaagnatpipgyviqssaqvsddsavskpgfptsgwypvssrstvyagllqngkya
    dpfystnmqnvpaaqfsvpwwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdq
    vngaytrhdlditaqvhtgvnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlv
    rrsgavalrsahviqklnsaldhadltvkadvrndsanavqttvagtvagkpisqtvsla
    akerktvtfplvgldrpnvwwpagmggqhrydldltasvggtpsdaakskfgvrdvkatl
    nssggrqysvngkpllirgggytpdlflrwnetaaadklkyvlnlglntvrleghiepde
    ffdiaddlgvltmpgweccdkwegqvngeekgepwvesdypiakasmfseaerlrdhpsv
    isfhigsdfapdrrieqgyldamkaadfllpvipaasarpspitgasgmkmngpydyvpp
    vywydksqkdrggawsfnsetsagvdiptmdtlkrmmsaseldtmwknpsakqyhrsssd
    tfgnlklfgdaltkrygasanlndfvrkaqlsqyenvraefeshsrnytdstnpstgliy
    wmlnspwtslhwqlfdaymdqngayygakkaneplhiqyshdnrsvvvinqtsnavsglt
    attklynldgtekysntktglsvgalgakatavtvpavsglsttylaknvltdssgkevs
    rnvywlstkadtlnwggsdwyytpqsafadlsglnnlgqsavgatansvagadgtttttv
    tlkntsggrlpafyvdskvvdsagkpvlpvewndnavslwpgetttltakyrtadlkgsk
    psvrisgwntgtqtvpad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vzsB (B:)
    vsfrqkrtripllamtvtalaaavcgvttapaatgaevavplsvgaaagnatpipgyviq
    ssaqvsddsavskpgfptsgwypvssrstvyagllqngkyadpfystnmqnvpaaqfsvp
    wwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdqvngaytrhdlditaqvhtg
    vnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlvrrsgavalrsahviqklns
    aldhadltvkadvrndsanavqttvagtvagkpisqtvslaakerktvtfplvgldrpnv
    wwpagmggqhrydldltasvggtpsdaakskfgvrdvkatlnssggrqysvngkpllirg
    ggytpdlflrwnetaaadklkyvlnlglntvrleghiepdeffdiaddlgvltmpgwecc
    dkwegqvngeekgepwvesdypiakasmfseaerlrdhpsvisfhigsdfapdrrieqgy
    ldamkaadfllpvipaasarpspitgasgmkmngpydyvppvywydksqkdrggawsfns
    etsagvdiptmdtlkrmmsaseldtmwknpsakqyhrsssdtfgnlklfgdaltkrygas
    anlndfvrkaqlsqyenvraefeshsrnytdstnpstgliywmlnspwtslhwqlfdaym
    dqngayygakkaneplhiqyshdnrsvvvinqtsnavsgltattklynldgtekysntkt
    glsvgalgakatavtvpavsglsttylaknvltdssgkevsrnvywlstkadtlnwggsd
    wyytpqsafadlsglnnlgqsavgatansvagadgtttttvtlkntsggrlpafyvdskv
    vdsagkpvlpvewndnavslwpgetttltakyrtadlkgskpsvrisgwntgtqtvpadg
    sgpgpsdpvdyqaedativqgavesnhagytgtgfvnydnvagssvewtvtvpsagtydv
    vvryangtttsrpldfsvngsisasgvafgstgtwpawttktvrvtlaagvnkikavatt
    anggpnvdkitl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vzsB (B:)
    lsvgaaagnatpipgyviqssaqvsddsavskpgfptsgwypvssrstvyagllqngkya
    dpfystnmqnvpaaqfsvpwwyrtdlnvddtssrtyldfsgvlskadvwvngtkvatkdq
    vngaytrhdlditaqvhtgvnsvafkvypndpnrdlsmgwidwaqtppdqnmgivrdvlv
    rrsgavalrsahviqklnsaldhadltvkadvrndsanavqttvagtvagkpisqtvsla
    akerktvtfplvgldrpnvwwpagmggqhrydldltasvggtpsdaakskfgvrdvkatl
    nssggrqysvngkpllirgggytpdlflrwnetaaadklkyvlnlglntvrleghiepde
    ffdiaddlgvltmpgweccdkwegqvngeekgepwvesdypiakasmfseaerlrdhpsv
    isfhigsdfapdrrieqgyldamkaadfllpvipaasarpspitgasgmkmngpydyvpp
    vywydksqkdrggawsfnsetsagvdiptmdtlkrmmsaseldtmwknpsakqyhrsssd
    tfgnlklfgdaltkrygasanlndfvrkaqlsqyenvraefeshsrnytdstnpstgliy
    wmlnspwtslhwqlfdaymdqngayygakkaneplhiqyshdnrsvvvinqtsnavsglt
    attklynldgtekysntktglsvgalgakatavtvpavsglsttylaknvltdssgkevs
    rnvywlstkadtlnwggsdwyytpqsafadlsglnnlgqsavgatansvagadgtttttv
    tlkntsggrlpafyvdskvvdsagkpvlpvewndnavslwpgetttltakyrtadlkgsk
    psvrisgwntgtqtvpad