![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
![]() | Protein Exochitosanase CsxA [159383] (1 species) |
![]() | Species Amycolatopsis orientalis [TaxId:31958] [159384] (3 PDB entries) Uniprot Q56F26 336-674 |
![]() | Domain d2vzsb5: 2vzs B:336-674 [153736] Other proteins in same PDB: d2vzsa1, d2vzsa2, d2vzsa3, d2vzsa4, d2vzsb1, d2vzsb2, d2vzsb3, d2vzsb4 automated match to d2vzsa5 complexed with cd, gcs, gol |
PDB Entry: 2vzs (more details), 1.85 Å
SCOPe Domain Sequences for d2vzsb5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vzsb5 c.1.8.3 (B:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} dvkatlnssggrqysvngkpllirgggytpdlflrwnetaaadklkyvlnlglntvrleg hiepdeffdiaddlgvltmpgweccdkwegqvngeekgepwvesdypiakasmfseaerl rdhpsvisfhigsdfapdrrieqgyldamkaadfllpvipaasarpspitgasgmkmngp ydyvppvywydksqkdrggawsfnsetsagvdiptmdtlkrmmsaseldtmwknpsakqy hrsssdtfgnlklfgdaltkrygasanlndfvrkaqlsqyenvraefeshsrnytdstnp stgliywmlnspwtslhwqlfdaymdqngayygakkane
Timeline for d2vzsb5: