Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.1: Galactose-binding domain [49786] (2 proteins) automatically mapped to Pfam PF00754 |
Protein Galactose oxidase, N-terminal domain [49787] (3 species) |
Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [158956] (6 PDB entries) |
Domain d2vz3a2: 2vz3 A:1-150 [153725] Other proteins in same PDB: d2vz3a1, d2vz3a3 automated match to d1gofa2 complexed with act, cu |
PDB Entry: 2vz3 (more details), 1.9 Å
SCOPe Domain Sequences for d2vz3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vz3a2 b.18.1.1 (A:1-150) Galactose oxidase, N-terminal domain {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]} asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp aryvrlvaiteangqpwtsiaeinvfqass
Timeline for d2vz3a2: