Lineage for d2vz3a1 (2vz3 A:538-639)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765186Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 2765311Protein Galactose oxidase, C-terminal domain [49209] (3 species)
    follows the catalytic seven-bladed beta-propeller domain
  7. 2765319Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [158881] (6 PDB entries)
  8. 2765321Domain d2vz3a1: 2vz3 A:538-639 [153724]
    Other proteins in same PDB: d2vz3a2, d2vz3a3
    automated match to d1gofa1
    complexed with act, cu

Details for d2vz3a1

PDB Entry: 2vz3 (more details), 1.9 Å

PDB Description: bleached galactose oxidase
PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d2vz3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vz3a1 b.1.18.2 (A:538-639) Galactose oxidase, C-terminal domain {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn
ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq

SCOPe Domain Coordinates for d2vz3a1:

Click to download the PDB-style file with coordinates for d2vz3a1.
(The format of our PDB-style files is described here.)

Timeline for d2vz3a1: