Lineage for d2vxjj_ (2vxj J:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774647Family b.18.1.16: PA-IL, galactose-binding lectin 1 [82022] (1 protein)
    a truncated form of this fold lacking one of the N-terminal strands
    automatically mapped to Pfam PF07828
  6. 2774648Protein PA-IL, galactose-binding lectin 1 [82023] (1 species)
  7. 2774649Species Pseudomonas aeruginosa [TaxId:287] [82024] (21 PDB entries)
  8. 2774726Domain d2vxjj_: 2vxj J: [153689]
    automated match to d1l7la_
    complexed with bgc, ca, edo

Details for d2vxjj_

PDB Entry: 2vxj (more details), 1.9 Å

PDB Description: crystal structure of pa-il lectin complexed with agal13bgal14glc at 1.9 a resolution
PDB Compounds: (J:) PA-I galactophilic lectin

SCOPe Domain Sequences for d2vxjj_:

Sequence, based on SEQRES records: (download)

>d2vxjj_ b.18.1.16 (J:) PA-IL, galactose-binding lectin 1 {Pseudomonas aeruginosa [TaxId: 287]}
awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
s

Sequence, based on observed residues (ATOM records): (download)

>d2vxjj_ b.18.1.16 (J:) PA-IL, galactose-binding lectin 1 {Pseudomonas aeruginosa [TaxId: 287]}
awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
fcgalvmkignsgtipvntglfrwvannvqgaitliyndvpgtygnnsgsfsvnigkdqs

SCOPe Domain Coordinates for d2vxjj_:

Click to download the PDB-style file with coordinates for d2vxjj_.
(The format of our PDB-style files is described here.)

Timeline for d2vxjj_: