Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.16: PA-IL, galactose-binding lectin 1 [82022] (1 protein) a truncated form of this fold lacking one of the N-terminal strands automatically mapped to Pfam PF07828 |
Protein PA-IL, galactose-binding lectin 1 [82023] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [82024] (21 PDB entries) |
Domain d2vxju_: 2vxj U: [153700] automated match to d1l7la_ complexed with bgc, ca, edo |
PDB Entry: 2vxj (more details), 1.9 Å
SCOPe Domain Sequences for d2vxju_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vxju_ b.18.1.16 (U:) PA-IL, galactose-binding lectin 1 {Pseudomonas aeruginosa [TaxId: 287]} awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq s
Timeline for d2vxju_: