Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) consists of one domain of this fold |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
Protein automated matches [190162] (6 species) not a true protein |
Species Thermococcus gorgonarius [TaxId:71997] [225933] (6 PDB entries) |
Domain d2vwka1: 2vwk A:1-347 [153677] Other proteins in same PDB: d2vwka2 automated match to d1tgoa1 complexed with na, so4 |
PDB Entry: 2vwk (more details), 2.6 Å
SCOPe Domain Sequences for d2vwka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vwka1 c.55.3.5 (A:1-347) automated matches {Thermococcus gorgonarius [TaxId: 71997]} mildtdyitedgkpvirifkkengefkidydrnfepyiyallkddsaiedvkkitaerhg ttvrvvraekvkkkflgrpievwklyfthpqdqpairdkikehpavvdiyeydipfakry lidkglipmegdeelkmlafdietlyhegekfaegpilmisyadeegarvitwrnidlpy vdvvstekemikrflkvvkekdpdvlityngdnfafaylkkrseklgvkfilgregsepk iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeaifgqpkekvyaeeiaqawe tgeglervarysmedakvtyelgkeffpmeaqlsrlvgqslwdvsrs
Timeline for d2vwka1: