SCOPe 2.07: Domain d2vv5a2: 2vv5 A:180-280

Lineage for d2vv5a2 (2vv5 A:180-280)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.43: Mechanosensitive channel protein MscS (YggB), C-terminal domain [82689] (1 family)
   the last strand of the fold is flipped away and involved in oligomerisation

5. Family d.58.43.1: Mechanosensitive channel protein MscS (YggB), C-terminal domain [82690] (1 protein)

6. Protein Mechanosensitive channel protein MscS (YggB), C-terminal domain [82691] (1 species)

7. Species Escherichia coli [TaxId:562] [82692] (2 PDB entries)

8. Domain d2vv5a2: 2vv5 A:180-280 [153614]
   Other proteins in same PDB: d2vv5a1, d2vv5a3, d2vv5b1, d2vv5b3, d2vv5c1, d2vv5c3, d2vv5d1, d2vv5d3, d2vv5e1, d2vv5e3, d2vv5f1, d2vv5f3, d2vv5g1, d2vv5g3
   automatically matched to d2oaua2

Details for d2vv5a2

PDB Entry: 2vv5, 3.45 Å

PDB Description: the open structure of mscs

PDB Compounds: (A:) Small-conductance mechanosensitive channel

SCOPe Domain Sequences for d2vv5a2:

Sequence; same for both SEQRES and ATOM records:

>d2vv5a2 d.58.43.1 (A:180-280) Mechanosensitive channel protein MscS (YggB), C-terminal domain {Escherichia coli [TaxId: 562]}
repvrrnefiigvaydsdidqvkqiltniiqsedrilkdremtvrlnelgassinfvvrv
wsnsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrv

Timeline for d2vv5a2:

• d2vv5a2 first appeared in SCOP 1.75
  
• d2vv5a2 appears in SCOPe 2.06
  
• d2vv5a2 appears in the current release, SCOPe 2.08