Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.43: Mechanosensitive channel protein MscS (YggB), C-terminal domain [82689] (1 family) the last strand of the fold is flipped away and involved in oligomerisation |
Family d.58.43.1: Mechanosensitive channel protein MscS (YggB), C-terminal domain [82690] (1 protein) |
Protein Mechanosensitive channel protein MscS (YggB), C-terminal domain [82691] (1 species) |
Species Escherichia coli [TaxId:562] [82692] (2 PDB entries) |
Domain d2vv5a2: 2vv5 A:180-280 [153614] Other proteins in same PDB: d2vv5a1, d2vv5a3, d2vv5b1, d2vv5b3, d2vv5c1, d2vv5c3, d2vv5d1, d2vv5d3, d2vv5e1, d2vv5e3, d2vv5f1, d2vv5f3, d2vv5g1, d2vv5g3 automatically matched to d2oaua2 mutant |
PDB Entry: 2vv5 (more details), 3.45 Å
SCOP Domain Sequences for d2vv5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vv5a2 d.58.43.1 (A:180-280) Mechanosensitive channel protein MscS (YggB), C-terminal domain {Escherichia coli [TaxId: 562]} repvrrnefiigvaydsdidqvkqiltniiqsedrilkdremtvrlnelgassinfvvrv wsnsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrv
Timeline for d2vv5a2: