![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) ![]() |
![]() | Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
![]() | Protein BIR domains of XIAP [57928] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57929] (14 PDB entries) Uniprot P98170 241-356 |
![]() | Domain d2vsla1: 2vsl A:250-345 [153528] automatically matched to d1f9xa_ complexed with 15p, zn |
PDB Entry: 2vsl (more details), 2.1 Å
SCOPe Domain Sequences for d2vsla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vsla1 g.52.1.1 (A:250-345) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]} fpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltd wkpsedpweqhakwypgckylleqkgqeyinnihlt
Timeline for d2vsla1: