PDB entry 2vsl

View 2vsl on RCSB PDB site
Description: crystal structure of xiap bir3 with a bivalent smac mimetic
Class: ligase
Keywords: zinc-finger, polymorphism, smac mimetic, metal-binding, ubl conjugation pathway, thiol protease inhibitor, phosphoprotein, ubl conjugation, protease inhibitor, bir3, zinc, xiap, ligase, apoptosis, cytoplasm, hydrolase inhibitor
Deposited on 2008-04-24, released 2008-09-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.218
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: baculoviral iap repeat-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2vsla1
  • Chain 'B':
    Compound: peptide (maa-lys-pro-phe)
    Database cross-references and differences (RAF-indexed):
    • PDB 2VSL (0-3)
  • Heterogens: 15P, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2vslA (A:)
fpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcgggltd
wkpsedpweqhakwypgckylleqkgqeyinnihlt

  • Chain 'B':
    No sequence available.