![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.223: Triger factor/SurA peptide-binding domain-like [109997] (1 superfamily) multihelical; irregular array of long and short helices |
![]() | Superfamily a.223.1: Triger factor/SurA peptide-binding domain-like [109998] (3 families) ![]() there are sequence and functional similarities between the families, but their structural similarity is obscured by conformational flexibility (in the TF family) |
![]() | Family a.223.1.1: TF C-terminus [109999] (1 protein) Pfam PF05698; includes the upstream linker region not covered by the Pfam model |
![]() | Protein Trigger factor, C-terminal domain [110000] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [110001] (2 PDB entries) Uniprot P22257 |
![]() | Domain d2vrha1: 2vrh A:248-431 [153506] Other proteins in same PDB: d2vrha2, d2vrha3, d2vrhb1, d2vrhc1, d2vrhd1 automatically matched to d1w26a1 protein/RNA complex |
PDB Entry: 2vrh (more details)
SCOPe Domain Sequences for d2vrha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vrha1 a.223.1.1 (A:248-431) Trigger factor, C-terminal domain {Escherichia coli [TaxId: 562]} ltaefikrfgvedgsveglraevrknmerelksairnrvksqaieglvkandidvpaali dseidvlrrqaaqrfggnekqalelprelfeeqakrrvvvglllgevirtnelkadeerv kglieemasayedpkeviefysknkelmdnmrnvaleeqaveavlakakvtekettfnel mnqq
Timeline for d2vrha1: