Lineage for d2vrha1 (2vrh A:248-431)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2350771Fold a.223: Triger factor/SurA peptide-binding domain-like [109997] (1 superfamily)
    multihelical; irregular array of long and short helices
  4. 2350772Superfamily a.223.1: Triger factor/SurA peptide-binding domain-like [109998] (3 families) (S)
    there are sequence and functional similarities between the families, but their structural similarity is obscured by conformational flexibility (in the TF family)
  5. 2350773Family a.223.1.1: TF C-terminus [109999] (1 protein)
    Pfam PF05698; includes the upstream linker region not covered by the Pfam model
  6. 2350774Protein Trigger factor, C-terminal domain [110000] (2 species)
  7. 2350775Species Escherichia coli [TaxId:562] [110001] (2 PDB entries)
    Uniprot P22257
  8. 2350778Domain d2vrha1: 2vrh A:248-431 [153506]
    Other proteins in same PDB: d2vrha2, d2vrha3, d2vrhb1, d2vrhc1, d2vrhd1
    automatically matched to d1w26a1
    protein/RNA complex

Details for d2vrha1

PDB Entry: 2vrh (more details)

PDB Description: structure of the e. coli trigger factor bound to a translating ribosome
PDB Compounds: (A:) Trigger Factor

SCOPe Domain Sequences for d2vrha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vrha1 a.223.1.1 (A:248-431) Trigger factor, C-terminal domain {Escherichia coli [TaxId: 562]}
ltaefikrfgvedgsveglraevrknmerelksairnrvksqaieglvkandidvpaali
dseidvlrrqaaqrfggnekqalelprelfeeqakrrvvvglllgevirtnelkadeerv
kglieemasayedpkeviefysknkelmdnmrnvaleeqaveavlakakvtekettfnel
mnqq

SCOPe Domain Coordinates for d2vrha1:

Click to download the PDB-style file with coordinates for d2vrha1.
(The format of our PDB-style files is described here.)

Timeline for d2vrha1: