Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
Protein 70S ribosome functional complex [58121] (4 species) |
Species Thermus thermophilus [TaxId:274] [58122] (20 PDB entries) |
Domain d2vqfs1: 2vqf S:2-81 [153462] Other proteins in same PDB: d2vqfb1, d2vqfd1, d2vqfe1, d2vqff1, d2vqfg1, d2vqfh1, d2vqfi1, d2vqfj1, d2vqfk1, d2vqfm1, d2vqfn1, d2vqfq1, d2vqfr1, d2vqft1, d2vqfu1 automatically matched to d1ibms_ complexed with k, mg, par, zn |
PDB Entry: 2vqf (more details), 2.9 Å
SCOPe Domain Sequences for d2vqfs1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vqfs1 i.1.1.1 (S:2-81) 70S ribosome functional complex {Thermus thermophilus [TaxId: 274]} prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy itenmvghklgefaptrtyr
Timeline for d2vqfs1: