Lineage for d2vqfg1 (2vqf G:2-156)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2331851Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 2331852Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 2331853Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 2331854Protein Ribosomal protein S7 [47975] (4 species)
  7. 2331884Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 2331899Domain d2vqfg1: 2vqf G:2-156 [153450]
    Other proteins in same PDB: d2vqfb1, d2vqfd1, d2vqfe1, d2vqff1, d2vqfh1, d2vqfi1, d2vqfj1, d2vqfk1, d2vqfl1, d2vqfm1, d2vqfn1, d2vqfo1, d2vqfp1, d2vqfq1, d2vqfr1, d2vqfs1, d2vqft1, d2vqfu1
    automatically matched to d1fjgg_
    complexed with k, mg, par, zn

Details for d2vqfg1

PDB Entry: 2vqf (more details), 2.9 Å

PDB Description: modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d2vqfg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vqfg1 a.75.1.1 (G:2-156) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOPe Domain Coordinates for d2vqfg1:

Click to download the PDB-style file with coordinates for d2vqfg1.
(The format of our PDB-style files is described here.)

Timeline for d2vqfg1: