SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2vq0c1 (2vq0 C:73-268)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2075626Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2076096Family b.121.4.7: Tombusviridae-like VP [88643] (5 protein domains)
  6. 2076107Protein Sobemovirus coat protein [88644] (4 species)
  7. 2076120Species SMV (Sesbania mosaic virus) [TaxId:12558] [49624] (5 PDB entries)
    Uniprot Q9EB06
  8. 2076126Domain d2vq0c1: 2vq0 C:73-268 [153424]
    automatically matched to d1vaka_
    complexed with ca; mutant

Details for d2vq0c1

PDB Entry: 2vq0 (more details), 3.6 Å

PDB Description: Capsid structure of Sesbania mosaic virus coat protein deletion mutant rCP(delta 48 to 59)
PDB Compounds: (C:) coat protein

SCOPe Domain Sequences for d2vq0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vq0c1 b.121.4.7 (C:73-268) Sobemovirus coat protein {SMV (Sesbania mosaic virus) [TaxId: 12558]}
gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
tytiqmieptasalnn

SCOPe Domain Coordinates for d2vq0c1:

Click to download the PDB-style file with coordinates for d2vq0c1.
(The format of our PDB-style files is described here.)

Timeline for d2vq0c1: