Lineage for d2vq0c1 (2vq0 C:73-268)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822375Family b.121.4.7: Tombusviridae-like VP [88643] (5 proteins)
  6. 2822386Protein Sobemovirus coat protein [88644] (4 species)
  7. 2822399Species SMV (Sesbania mosaic virus) [TaxId:12558] [49624] (5 PDB entries)
    Uniprot Q9EB06
  8. 2822405Domain d2vq0c1: 2vq0 C:73-268 [153424]
    automatically matched to d1vaka_
    complexed with ca; mutant

Details for d2vq0c1

PDB Entry: 2vq0 (more details), 3.6 Å

PDB Description: capsid structure of sesbania mosaic virus coat protein deletion mutant rcp(delta 48 to 59)
PDB Compounds: (C:) coat protein

SCOPe Domain Sequences for d2vq0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vq0c1 b.121.4.7 (C:73-268) Sobemovirus coat protein {SMV (Sesbania mosaic virus) [TaxId: 12558]}
gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvwsgsaglcfingtrcsdtstais
ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
tytiqmieptasalnn

SCOPe Domain Coordinates for d2vq0c1:

Click to download the PDB-style file with coordinates for d2vq0c1.
(The format of our PDB-style files is described here.)

Timeline for d2vq0c1: