Lineage for d2vp0a_ (2vp0 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2123294Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 2123507Protein Deoxyribonucleoside kinase [69478] (1 species)
  7. 2123508Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69479] (11 PDB entries)
  8. 2123515Domain d2vp0a_: 2vp0 A: [153395]
    automated match to d1ot3a_
    protein/DNA complex; complexed with mg, ttp

Details for d2vp0a_

PDB Entry: 2vp0 (more details), 2.2 Å

PDB Description: structural studies of nucleoside analog and feedback inhibitor binding to drosophila melanogaster multisubstrate deoxyribonucleoside kinase
PDB Compounds: (A:) deoxynucleoside kinase

SCOPe Domain Sequences for d2vp0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vp0a_ c.37.1.1 (A:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqrrpqsckvlvldad

SCOPe Domain Coordinates for d2vp0a_:

Click to download the PDB-style file with coordinates for d2vp0a_.
(The format of our PDB-style files is described here.)

Timeline for d2vp0a_: