| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
| Protein Deoxyribonucleoside kinase [69478] (1 species) |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69479] (11 PDB entries) |
| Domain d2vp0a_: 2vp0 A: [153395] automated match to d1ot3a_ protein/DNA complex; complexed with mg, ttp has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2vp0 (more details), 2.2 Å
SCOPe Domain Sequences for d2vp0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vp0a_ c.37.1.1 (A:) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvnllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqrrpqsckvlvldad
Timeline for d2vp0a_: