Lineage for d2vhpr1 (2vhp R:19-73)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695537Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 2695538Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 2695539Protein Ribosomal protein S18 [46913] (2 species)
  7. 2695540Species Escherichia coli [TaxId:562] [158351] (24 PDB entries)
    Uniprot P0A7T7 19-73
  8. 2695558Domain d2vhpr1: 2vhp R:19-73 [153162]
    Other proteins in same PDB: d2vhpb1, d2vhpc1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpe2, d2vhpf1, d2vhpg1, d2vhph1, d2vhpi1, d2vhpj1, d2vhpk1, d2vhpl1, d2vhpm1, d2vhpn1, d2vhpo1, d2vhpp1, d2vhpq1, d2vhps1, d2vhpt1, d2vhpu1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2vhpr1

PDB Entry: 2vhp (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 4 of 4)
PDB Compounds: (R:) 30S ribosomal protein S18

SCOPe Domain Sequences for d2vhpr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhpr1 a.4.8.1 (R:19-73) Ribosomal protein S18 {Escherichia coli [TaxId: 562]}
eidykdiatlknyitesgkivpsritgtrakyqrqlaraikrarylsllpytdrh

SCOPe Domain Coordinates for d2vhpr1:

Click to download the PDB-style file with coordinates for d2vhpr1.
(The format of our PDB-style files is described here.)

Timeline for d2vhpr1: