Class a: All alpha proteins [46456] (286 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (9 families) |
Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
Protein automated matches [190103] (4 species) not a true protein |
Species Yersinia enterocolitica [TaxId:630] [161324] (1 PDB entry) |
Domain d2vgxa1: 2vgx A:37-100 [153046] automatically matched to d2avpa1 |
PDB Entry: 2vgx (more details), 1.95 Å
SCOPe Domain Sequences for d2vgxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vgxa1 a.118.8.1 (A:37-100) automated matches {Yersinia enterocolitica [TaxId: 630]} eqlyslafnqyqsgkyedahkvfqalcvldhydsrfflglgacrqamgqydlaihsysyg avmd
Timeline for d2vgxa1: