Lineage for d2vgxa1 (2vgx A:37-100)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726650Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 2726794Protein automated matches [190103] (5 species)
    not a true protein
  7. 2726829Species Yersinia enterocolitica [TaxId:630] [161324] (1 PDB entry)
  8. 2726830Domain d2vgxa1: 2vgx A:37-100 [153046]
    automatically matched to d2avpa1

Details for d2vgxa1

PDB Entry: 2vgx (more details), 1.95 Å

PDB Description: structure of the yersinia enterocolitica type iii secretion translocator chaperone sycd
PDB Compounds: (A:) chaperone sycd

SCOPe Domain Sequences for d2vgxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vgxa1 a.118.8.1 (A:37-100) automated matches {Yersinia enterocolitica [TaxId: 630]}
eqlyslafnqyqsgkyedahkvfqalcvldhydsrfflglgacrqamgqydlaihsysyg
avmd

SCOPe Domain Coordinates for d2vgxa1:

Click to download the PDB-style file with coordinates for d2vgxa1.
(The format of our PDB-style files is described here.)

Timeline for d2vgxa1: