Lineage for d2vdba2 (2vdb A:389-579)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 924235Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 924236Superfamily a.126.1: Serum albumin-like [48552] (1 family) (S)
  5. 924237Family a.126.1.1: Serum albumin-like [48553] (2 proteins)
  6. 924238Protein Serum albumin [48554] (1 species)
    duplication: consists of three domains of this fold
  7. 924239Species Human (Homo sapiens) [TaxId:9606] [48555] (50 PDB entries)
    Uniprot P02768 29-596
  8. 924332Domain d2vdba2: 2vdb A:389-579 [152971]
    Other proteins in same PDB: d2vdbb_
    automatically matched to d1bj5a3
    complexed with dka, nps

Details for d2vdba2

PDB Entry: 2vdb (more details), 2.52 Å

PDB Description: structure of human serum albumin with s-naproxen and the ga module
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d2vdba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vdba2 a.126.1.1 (A:389-579) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc
aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft
fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf
aeegkklvaas

SCOPe Domain Coordinates for d2vdba2:

Click to download the PDB-style file with coordinates for d2vdba2.
(The format of our PDB-style files is described here.)

Timeline for d2vdba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vdba1
View in 3D
Domains from other chains:
(mouse over for more information)
d2vdbb_