Class a: All alpha proteins [46456] (284 folds) |
Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (1 family) |
Family a.126.1.1: Serum albumin-like [48553] (2 proteins) |
Protein Serum albumin [48554] (1 species) duplication: consists of three domains of this fold |
Species Human (Homo sapiens) [TaxId:9606] [48555] (50 PDB entries) Uniprot P02768 29-596 |
Domain d2vdba2: 2vdb A:389-579 [152971] Other proteins in same PDB: d2vdbb1 automatically matched to d1bj5a3 complexed with dka, nps |
PDB Entry: 2vdb (more details), 2.52 Å
SCOP Domain Sequences for d2vdba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vdba2 a.126.1.1 (A:389-579) Serum albumin {Human (Homo sapiens) [TaxId: 9606]} kqncelfeqlgeykfqnallvrytkkvpqvstptlvevsrnlgkvgskcckhpeakrmpc aedylsvvlnqlcvlhektpvsdrvtkccteslvnrrpcfsalevdetyvpkefnaetft fhadictlsekerqikkqtalvelvkhkpkatkeqlkavmddfaafvekcckaddketcf aeegkklvaas
Timeline for d2vdba2: