SCOPe 2.04: Domain d2vd1d1: 2vd1 D:76-199

Lineage for d2vd1d1 (2vd1 D:76-199)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224956] (35 PDB entries)

8. Domain d2vd1d1: 2vd1 D:76-199 [152968]
   Other proteins in same PDB: d2vd1a2, d2vd1b2, d2vd1c2, d2vd1d2
   automated match to d1pd211
   complexed with d28, gsh, mg

Details for d2vd1d1

PDB Entry: 2vd1, 2.25 Å

PDB Description: complex structure of prostaglandin d2 synthase at 2.25a.

PDB Compounds: (D:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d2vd1d1:

Sequence; same for both SEQRES and ATOM records:

>d2vd1d1 a.45.1.1 (D:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

Timeline for d2vd1d1:

• d2vd1d1 first appeared in SCOP 1.75
  
• d2vd1d1 appears in SCOPe 2.03
  
• d2vd1d1 appears in SCOPe 2.05
  
• d2vd1d1 appears in the current release, SCOPe 2.08