Lineage for d2vd1b1 (2vd1 B:76-199)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491601Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1491602Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1491603Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1492203Protein automated matches [226848] (10 species)
    not a true protein
  7. 1492217Species Human (Homo sapiens) [TaxId:9606] [224956] (35 PDB entries)
  8. 1492286Domain d2vd1b1: 2vd1 B:76-199 [152964]
    Other proteins in same PDB: d2vd1a2, d2vd1b2, d2vd1c2, d2vd1d2
    automated match to d1pd211
    complexed with d28, gsh, mg

Details for d2vd1b1

PDB Entry: 2vd1 (more details), 2.25 Å

PDB Description: complex structure of prostaglandin d2 synthase at 2.25a.
PDB Compounds: (B:) glutathione-requiring prostaglandin d synthase

SCOPe Domain Sequences for d2vd1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vd1b1 a.45.1.1 (B:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl

SCOPe Domain Coordinates for d2vd1b1:

Click to download the PDB-style file with coordinates for d2vd1b1.
(The format of our PDB-style files is described here.)

Timeline for d2vd1b1: