| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein automated matches [226848] (11 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries) |
| Domain d2vcxd1: 2vcx D:76-199 [152944] Other proteins in same PDB: d2vcxa2, d2vcxb2, d2vcxc2, d2vcxd2 automated match to d1pd211 complexed with d26, gsh, mg |
PDB Entry: 2vcx (more details), 2.1 Å
SCOPe Domain Sequences for d2vcxd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vcxd1 a.45.1.1 (D:76-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnelltynaphlmqdldtyl
ggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkvqaipavanwikrrp
qtkl
Timeline for d2vcxd1: