Lineage for d2vcwb2 (2vcw B:2-75)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833461Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 833462Superfamily c.47.1: Thioredoxin-like [52833] (23 families) (S)
  5. 833722Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 834130Protein Class sigma GST [81362] (5 species)
  7. 834143Species Human (Homo sapiens) [TaxId:9606] [89705] (11 PDB entries)
    Uniprot O60760
    synonym: hematopoietic prostaglandin D synthase
  8. 834165Domain d2vcwb2: 2vcw B:2-75 [152933]
    Other proteins in same PDB: d2vcwa1, d2vcwb1, d2vcwc1, d2vcwd1
    automatically matched to d1iyha2
    complexed with gsh, zza

Details for d2vcwb2

PDB Entry: 2vcw (more details), 1.95 Å

PDB Description: complex structure of prostaglandin d2 synthase at 1.95a.
PDB Compounds: (B:) glutathione-requiring prostaglandin d synthase

SCOP Domain Sequences for d2vcwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vcwb2 c.47.1.5 (B:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}
pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
hqslaiaryltknt

SCOP Domain Coordinates for d2vcwb2:

Click to download the PDB-style file with coordinates for d2vcwb2.
(The format of our PDB-style files is described here.)

Timeline for d2vcwb2: