Lineage for d2vawa2 (2vaw A:209-316)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2959092Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2959093Protein Cell-division protein FtsZ [55309] (9 species)
  7. 2959138Species Pseudomonas aeruginosa [TaxId:287] [89982] (2 PDB entries)
  8. 2959141Domain d2vawa2: 2vaw A:209-316 [152857]
    Other proteins in same PDB: d2vawa1
    automatically matched to d1ofua2
    complexed with gdp

    missing some secondary structures that made up less than one-third of the common domain

Details for d2vawa2

PDB Entry: 2vaw (more details), 2.9 Å

PDB Description: ftsz pseudomonas aeruginosa gdp
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d2vawa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vawa2 d.79.2.1 (A:209-316) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]}
vdfadvktvmsemgmammgtgcasgpnrareateaairnplledvnlqgargilvnitag
pdlslgeysdvgniieqfasehatvkvgtvidadmrdelhvtvvatgl

SCOPe Domain Coordinates for d2vawa2:

Click to download the PDB-style file with coordinates for d2vawa2.
(The format of our PDB-style files is described here.)

Timeline for d2vawa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vawa1