Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein Cell-division protein FtsZ [55309] (9 species) |
Species Pseudomonas aeruginosa [TaxId:287] [89982] (2 PDB entries) |
Domain d2vawa2: 2vaw A:209-316 [152857] Other proteins in same PDB: d2vawa1 automatically matched to d1ofua2 complexed with gdp missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 2vaw (more details), 2.9 Å
SCOPe Domain Sequences for d2vawa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vawa2 d.79.2.1 (A:209-316) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]} vdfadvktvmsemgmammgtgcasgpnrareateaairnplledvnlqgargilvnitag pdlslgeysdvgniieqfasehatvkvgtvidadmrdelhvtvvatgl
Timeline for d2vawa2: