Lineage for d2vawa2 (2vaw A:209-316)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) 
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) Protein Cell-division protein FtsZ [55309] (9 species) 
Species Pseudomonas aeruginosa [TaxId:287] [89982] (2 PDB entries) 
Domain d2vawa2: 2vaw A:209-316 [152857]
Other proteins in same PDB: d2vawa1
automatically matched to d1ofua2
complexed with gdp
missing some secondary structures that made up less than one-third of the common domain
Details for d2vawa2
PDB Entry: 2vaw (more details), 2.9 Å
PDB Description: ftsz pseudomonas aeruginosa gdp
PDB Compounds: (A:) cell division protein ftszSCOPe Domain Sequences for d2vawa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vawa2 d.79.2.1 (A:209-316) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]}
vdfadvktvmsemgmammgtgcasgpnrareateaairnplledvnlqgargilvnitag
pdlslgeysdvgniieqfasehatvkvgtvidadmrdelhvtvvatgl
SCOPe Domain Coordinates for d2vawa2:
Click to download the PDB-style file with coordinates for d2vawa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2vawa2:
- d2vawa2 first appeared in SCOP 1.75
- d2vawa2 appears in SCOPe 2.07
View in 3D
