SCOP 1.75: Domain d2vawa2: 2vaw A:209-316

Lineage for d2vawa2 (2vaw A:209-316)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)

6. Protein Cell-division protein FtsZ [55309] (4 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [89982] (2 PDB entries)

8. Domain d2vawa2: 2vaw A:209-316 [152857]
   Other proteins in same PDB: d2vawa1
   automatically matched to d1ofua2
   complexed with gdp

Details for d2vawa2

PDB Entry: 2vaw, 2.9 Å

PDB Description: ftsz pseudomonas aeruginosa gdp

PDB Compounds: (A:) cell division protein ftsz

SCOP Domain Sequences for d2vawa2:

Sequence; same for both SEQRES and ATOM records:

>d2vawa2 d.79.2.1 (A:209-316) Cell-division protein FtsZ {Pseudomonas aeruginosa [TaxId: 287]}
vdfadvktvmsemgmammgtgcasgpnrareateaairnplledvnlqgargilvnitag
pdlslgeysdvgniieqfasehatvkvgtvidadmrdelhvtvvatgl

Timeline for d2vawa2:

• d2vawa2 is new in SCOP 1.75
  
• d2vawa2 appears in SCOPe 2.01
  
• d2vawa2 appears in the current release, SCOPe 2.08