Lineage for d2v68n_ (2v68 N:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957669Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2957670Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2957671Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2957834Protein automated matches [190066] (7 species)
    not a true protein
  7. 2957835Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (9 PDB entries)
  8. 2957889Domain d2v68n_: 2v68 N: [152665]
    Other proteins in same PDB: d2v68a1, d2v68a2, d2v68b1, d2v68b2, d2v68c1, d2v68c2, d2v68d1, d2v68d2, d2v68e1, d2v68e2, d2v68f1, d2v68f2, d2v68g1, d2v68g2, d2v68h1, d2v68h2
    automated match to d1ir21_
    complexed with cap, edo, mg; mutant

Details for d2v68n_

PDB Entry: 2v68 (more details), 2.3 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with large- subunit mutations v331a, t342i
PDB Compounds: (N:) ribulose bisphosphate carboxylase small chain 1

SCOPe Domain Sequences for d2v68n_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v68n_ d.73.1.1 (N:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpktardfqpankrsv

SCOPe Domain Coordinates for d2v68n_:

Click to download the PDB-style file with coordinates for d2v68n_.
(The format of our PDB-style files is described here.)

Timeline for d2v68n_: