Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) |
Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
Protein automated matches [190066] (7 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (9 PDB entries) |
Domain d2v68n_: 2v68 N: [152665] Other proteins in same PDB: d2v68a1, d2v68a2, d2v68b1, d2v68b2, d2v68c1, d2v68c2, d2v68d1, d2v68d2, d2v68e1, d2v68e2, d2v68f1, d2v68f2, d2v68g1, d2v68g2, d2v68h1, d2v68h2 automated match to d1ir21_ complexed with cap, edo, mg; mutant |
PDB Entry: 2v68 (more details), 2.3 Å
SCOPe Domain Sequences for d2v68n_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v68n_ d.73.1.1 (N:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg flvqrpktardfqpankrsv
Timeline for d2v68n_: