Lineage for d2v68f2 (2v68 F:9-149)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952998Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2952999Protein automated matches [226983] (27 species)
    not a true protein
  7. 2953040Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225547] (9 PDB entries)
  8. 2953086Domain d2v68f2: 2v68 F:9-149 [152655]
    Other proteins in same PDB: d2v68a1, d2v68b1, d2v68c1, d2v68d1, d2v68e1, d2v68f1, d2v68g1, d2v68h1, d2v68i_, d2v68j_, d2v68k_, d2v68l_, d2v68m_, d2v68n_, d2v68o_, d2v68p_
    automated match to d1gk8a2
    complexed with cap, edo, mg; mutant

Details for d2v68f2

PDB Entry: 2v68 (more details), 2.3 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with large- subunit mutations v331a, t342i
PDB Compounds: (F:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d2v68f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v68f2 d.58.9.0 (F:9-149) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
agagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwtt
vwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfk
alralrledlrippayvktfv

SCOPe Domain Coordinates for d2v68f2:

Click to download the PDB-style file with coordinates for d2v68f2.
(The format of our PDB-style files is described here.)

Timeline for d2v68f2: