Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) C-terminal domain is beta/alpha barrel |
Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
Protein automated matches [226983] (27 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225547] (9 PDB entries) |
Domain d2v68h2: 2v68 H:10-149 [152659] Other proteins in same PDB: d2v68a1, d2v68b1, d2v68c1, d2v68d1, d2v68e1, d2v68f1, d2v68g1, d2v68h1, d2v68i_, d2v68j_, d2v68k_, d2v68l_, d2v68m_, d2v68n_, d2v68o_, d2v68p_ automated match to d1gk8a2 complexed with cap, edo, mg; mutant |
PDB Entry: 2v68 (more details), 2.3 Å
SCOPe Domain Sequences for d2v68h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v68h2 d.58.9.0 (H:10-149) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} gagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttv wtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfka lralrledlrippayvktfv
Timeline for d2v68h2: