| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) ![]() |
| Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
| Protein automated matches [190066] (5 species) not a true protein |
| Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (7 PDB entries) |
| Domain d2v67i_: 2v67 I: [152636] Other proteins in same PDB: d2v67a1, d2v67a2, d2v67b1, d2v67b2, d2v67c1, d2v67c2, d2v67d1, d2v67d2, d2v67e1, d2v67e2, d2v67f1, d2v67f2, d2v67g1, d2v67g2, d2v67h1, d2v67h2 automated match to d1ir21_ complexed with cap, edo, mg; mutant |
PDB Entry: 2v67 (more details), 2 Å
SCOPe Domain Sequences for d2v67i_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v67i_ d.73.1.1 (I:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpktardfqpankrsv
Timeline for d2v67i_: