Lineage for d2v67h2 (2v67 H:10-149)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1909192Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 1909384Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 1909385Protein automated matches [226983] (12 species)
    not a true protein
  7. 1909408Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225547] (9 PDB entries)
  8. 1909440Domain d2v67h2: 2v67 H:10-149 [152635]
    Other proteins in same PDB: d2v67a1, d2v67b1, d2v67c1, d2v67d1, d2v67e1, d2v67f1, d2v67g1, d2v67h1, d2v67i_, d2v67j_, d2v67k_, d2v67l_, d2v67m_, d2v67n_, d2v67o_, d2v67p_
    automated match to d1gk8a2
    complexed with cap, edo, mg; mutant

Details for d2v67h2

PDB Entry: 2v67 (more details), 2 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large-subunit supressor mutation t342i
PDB Compounds: (H:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d2v67h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v67h2 d.58.9.0 (H:10-149) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttv
wtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfka
lralrledlrippayvktfv

SCOPe Domain Coordinates for d2v67h2:

Click to download the PDB-style file with coordinates for d2v67h2.
(The format of our PDB-style files is described here.)

Timeline for d2v67h2: