Lineage for d2v67l_ (2v67 L:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1913207Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1913208Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1913209Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1913367Protein automated matches [190066] (5 species)
    not a true protein
  7. 1913368Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (7 PDB entries)
  8. 1913396Domain d2v67l_: 2v67 L: [152639]
    Other proteins in same PDB: d2v67a1, d2v67a2, d2v67b1, d2v67b2, d2v67c1, d2v67c2, d2v67d1, d2v67d2, d2v67e1, d2v67e2, d2v67f1, d2v67f2, d2v67g1, d2v67g2, d2v67h1, d2v67h2
    automated match to d1ir21_
    complexed with cap, edo, mg; mutant

Details for d2v67l_

PDB Entry: 2v67 (more details), 2 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large-subunit supressor mutation t342i
PDB Compounds: (L:) ribulose bisphosphate carboxylase small chain 1

SCOPe Domain Sequences for d2v67l_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v67l_ d.73.1.1 (L:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpktardfqpankrsv

SCOPe Domain Coordinates for d2v67l_:

Click to download the PDB-style file with coordinates for d2v67l_.
(The format of our PDB-style files is described here.)

Timeline for d2v67l_: