Lineage for d2v4jd2 (2v4j D:2-167)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2562266Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) (S)
    duplication: contains two subdomains of this fold
  5. 2562308Family d.58.36.2: DsrA/DsrB N-terminal-domain-like [160336] (2 proteins)
    Dissimilatory sulfite reductase is a heterodimer of homologous DsrA and DsrB subunits, the assembly of which is similar to the architecture of duplicated sulfite reductase CysI
  6. 2562309Protein Dissimilatory sulfite reductase subunit alpha, DsrA [160337] (2 species)
  7. 2562327Species Desulfovibrio vulgaris [TaxId:881] [160339] (1 PDB entry)
    Uniprot P45574 2-437
  8. 2562329Domain d2v4jd2: 2v4j D:2-167 [152564]
    Other proteins in same PDB: d2v4ja1, d2v4ja3, d2v4jb1, d2v4jb2, d2v4jb3, d2v4jc1, d2v4jd1, d2v4jd3, d2v4je1, d2v4je2, d2v4je3, d2v4jf_
    automated match to d2v4ja2
    complexed with sf4, sh0, so3, srm

Details for d2v4jd2

PDB Entry: 2v4j (more details), 2.1 Å

PDB Description: the crystal structure of desulfovibrio vulgaris dissimilatory sulfite reductase bound to dsrc provides novel insights into the mechanism of sulfate respiration
PDB Compounds: (D:) sulfite reductase, dissimilatory-type subunit alpha

SCOPe Domain Sequences for d2v4jd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v4jd2 d.58.36.2 (D:2-167) Dissimilatory sulfite reductase subunit alpha, DsrA {Desulfovibrio vulgaris [TaxId: 881]}
akhatpkldqlesgpwpsfvsdikqeaayraanpkgldyqvpvdcpedllgvlelsydeg
ethwkhggivgvfgygggvigrycdqpekfpgvahfhtvrvaqpsgkyysadylrqlcdi
wdlrgsgltnmhgstgdivllgtqtpqleeiffelthnlntdlggs

SCOPe Domain Coordinates for d2v4jd2:

Click to download the PDB-style file with coordinates for d2v4jd2.
(The format of our PDB-style files is described here.)

Timeline for d2v4jd2: