| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (2 families) ![]() duplication: contains two subdomains of this fold |
| Family d.58.36.2: DsrA/DsrB N-terminal-domain-like [160336] (2 protein domains) Dissimilatory sulfite reductase is a heterodimer of homologous DsrA and DsrB subunits, the assembly of which is similar to the architecture of duplicated sulfite reductase CysI |
| Protein Dissimilatory sulfite reductase subunit alpha, DsrA [160337] (2 species) |
| Species Desulfovibrio vulgaris [TaxId:881] [160339] (1 PDB entry) Uniprot P45574 2-437 |
| Domain d2v4jd2: 2v4j D:2-167 [152564] Other proteins in same PDB: d2v4ja1, d2v4ja3, d2v4jb1, d2v4jb2, d2v4jb3, d2v4jc1, d2v4jd1, d2v4jd3, d2v4je1, d2v4je2, d2v4je3, d2v4jf1 automatically matched to 2V4J A:2-167 complexed with sf4, so3, srm |
| PDB Entry: 2v4j (more details) PDB Description: the crystal structure of desulfovibrio vulgaris dissimilatory sulfite reductase bound to dsrc provides novel insights into the mechanism of sulfate respiration
PDB Compounds: (D:) sulfite reductase, dissimilatory-type subunit alphaSCOP Domain Sequences for d2v4jd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v4jd2 d.58.36.2 (D:2-167) Dissimilatory sulfite reductase subunit alpha, DsrA {Desulfovibrio vulgaris [TaxId: 881]}
akhatpkldqlesgpwpsfvsdikqeaayraanpkgldyqvpvdcpedllgvlelsydeg
ethwkhggivgvfgygggvigrycdqpekfpgvahfhtvrvaqpsgkyysadylrqlcdi
wdlrgsgltnmhgstgdivllgtqtpqleeiffelthnlntdlggs
SCOP Domain Coordinates for d2v4jd2:
Click to download the PDB-style file with coordinates for d2v4jd2. (The format of our PDB-style files is described here.)
Timeline for d2v4jd2:
d2v4jd2 is new in SCOP 1.75 | d2v4jd2 (click for larger image) d2v4jd2 in context of chain Domains from same chain: d2v4jd1, d2v4jd3 d2v4jd2 in context of PDB Domains from other chains: d2v4ja1, d2v4ja2, d2v4ja3, d2v4jb1, d2v4jb2, d2v4jb3, d2v4jc1, d2v4je1, d2v4je2, d2v4je3, d2v4jf1 |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |