Structural Classification of Proteins and ASTRAL release 1.75 (June 2009)
Search SCOP (example):

Lineage for d2v4jd2 (2v4j D:2-167)

  1. Root: SCOP 1.75
  2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (2 families) (S)
    duplication: contains two subdomains of this fold
  5. Family d.58.36.2: DsrA/DsrB N-terminal-domain-like [160336] (2 protein domains)
    Dissimilatory sulfite reductase is a heterodimer of homologous DsrA and DsrB subunits, the assembly of which is similar to the architecture of duplicated sulfite reductase CysI
  6. Protein Dissimilatory sulfite reductase subunit alpha, DsrA [160337] (2 species)
  7. Species Desulfovibrio vulgaris [TaxId:881] [160339] (1 PDB entry)
    Uniprot P45574 2-437
  8. Domain d2v4jd2: 2v4j D:2-167 [152564]
    Other proteins in same PDB: d2v4ja1, d2v4ja3, d2v4jb1, d2v4jb2, d2v4jb3, d2v4jc1, d2v4jd1, d2v4jd3, d2v4je1, d2v4je2, d2v4je3, d2v4jf1
    automatically matched to 2V4J A:2-167
    complexed with sf4, so3, srm

Details for d2v4jd2

PDB Entry: 2v4j (more details)
PDB Description: the crystal structure of desulfovibrio vulgaris dissimilatory sulfite reductase bound to dsrc provides novel insights into the mechanism of sulfate respiration
PDB Compounds: (D:) sulfite reductase, dissimilatory-type subunit alpha

SCOP Domain Sequences for d2v4jd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v4jd2 d.58.36.2 (D:2-167) Dissimilatory sulfite reductase subunit alpha, DsrA {Desulfovibrio vulgaris [TaxId: 881]}
akhatpkldqlesgpwpsfvsdikqeaayraanpkgldyqvpvdcpedllgvlelsydeg
ethwkhggivgvfgygggvigrycdqpekfpgvahfhtvrvaqpsgkyysadylrqlcdi
wdlrgsgltnmhgstgdivllgtqtpqleeiffelthnlntdlggs

SCOP Domain Coordinates for d2v4jd2:

Click to download the PDB-style file with coordinates for d2v4jd2.
(The format of our PDB-style files is described here.)

Timeline for d2v4jd2:

d2v4jd2 is new in SCOP 1.75
d2v4jd2 appears in SCOP 1.75A


d2v4jd2
(click for larger image)


d2v4jd2 in context of chain
Domains from same chain:
d2v4jd1, d2v4jd3


d2v4jd2 in context of PDB
Domains from other chains:
d2v4ja1, d2v4ja2, d2v4ja3, d2v4jb1, d2v4jb2, d2v4jb3, d2v4jc1, d2v4je1, d2v4je2, d2v4je3, d2v4jf1

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu