![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) ![]() |
![]() | Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein) Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail |
![]() | Protein Ribosomal protein L32p [144201] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [161177] (7 PDB entries) Uniprot P80339 1-59 |
![]() | Domain d2v4751: 2v47 5:2-60 [152506] Other proteins in same PDB: d2v4741, d2v4761, d2v4771, d2v47c1, d2v47e1, d2v47f1, d2v47h1, d2v47h2, d2v47n1, d2v47p1, d2v47t1, d2v47u1, d2v47v1, d2v47y1, d2v47z1 automatically matched to 2J01 5:2-60 |
PDB Entry: 2v47 (more details), 3.8 Å
SCOP Domain Sequences for d2v4751:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v4751 g.41.8.5 (5:2-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]} akhpvpkkktskarrdarrshhaltpptlvpcpeckamkpphtvcpecgyyagrkvlev
Timeline for d2v4751: