Lineage for d2v47y1 (2v47 Y:2-102)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796588Superfamily b.34.5: Translation proteins SH3-like domain [50104] (7 families) (S)
    many known members contain KOW motif
  5. 796589Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)
  6. 796632Protein Ribosomal proteins L24 (L24p) [50106] (4 species)
  7. 796717Species Thermus thermophilus [TaxId:274] [159025] (11 PDB entries)
    Uniprot Q72I15 2-102
  8. 796722Domain d2v47y1: 2v47 Y:2-102 [152519]
    Other proteins in same PDB: d2v4741, d2v4751, d2v4761, d2v4771, d2v47c1, d2v47e1, d2v47f1, d2v47h1, d2v47h2, d2v47n1, d2v47p1, d2v47t1, d2v47u1, d2v47v1, d2v47z1
    automatically matched to 2J01 Y:2-102

Details for d2v47y1

PDB Entry: 2v47 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 2 of 4). This file contains the 50S subunit for Molecule 1.
PDB Compounds: (Y:) 50S ribosomal protein L24

SCOP Domain Sequences for d2v47y1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v47y1 b.34.5.1 (Y:2-102) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]}
rvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggfi
ekeaplhaskvrpicpacgkptrvrkkflengkkirvcakc

SCOP Domain Coordinates for d2v47y1:

Click to download the PDB-style file with coordinates for d2v47y1.
(The format of our PDB-style files is described here.)

Timeline for d2v47y1: